Thioredoxin 2 (Trx2/TXN2) Rabbit mAb, Clone: [ARC1003], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4424S
Article Name: Thioredoxin 2 (Trx2/TXN2) Rabbit mAb, Clone: [ARC1003], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4424S
Supplier Catalog Number: CNA4424S
Alternative Catalog Number: MBL-CNA4424S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 67-166 of human Thioredoxin 2 (Trx2/TXN2) (Trx2/TXN2) (Q99757).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1003]
Molecular Weight: 18kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Target: A synthetic peptide corresponding to a sequence within amino acids 67-166 of human Thioredoxin 2 (Trx2/TXN2) (Trx2/TXN2) (Q99757).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200