[KO Validated] PEPCK/PCK2 Rabbit mAb, Clone: [ARC1017], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4466S
Article Name: [KO Validated] PEPCK/PCK2 Rabbit mAb, Clone: [ARC1017], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4466S
Supplier Catalog Number: CNA4466S
Alternative Catalog Number: MBL-CNA4466S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1017]
Molecular Weight: 71kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200