NLGN4Y Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA4513S
Article Name: NLGN4Y Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA4513S
Supplier Catalog Number: CNA4513S
Alternative Catalog Number: MBL-CNA4513S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 122-256 of human NLGN4Y (NP_001157710.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 92kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: DMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 122-256 of human NLGN4Y (NP_001157710.1).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100