Casein Kinase 2 beta (CSNK2B) Rabbit mAb, Clone: [ARC1069], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4519S
Article Name: Casein Kinase 2 beta (CSNK2B) Rabbit mAb, Clone: [ARC1069], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4519S
Supplier Catalog Number: CNA4519S
Alternative Catalog Number: MBL-CNA4519S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1069]
Molecular Weight: 25kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200