STAT4 Rabbit mAb, Clone: [ARC1071], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4523S
Article Name: STAT4 Rabbit mAb, Clone: [ARC1071], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4523S
Supplier Catalog Number: CNA4523S
Alternative Catalog Number: MBL-CNA4523S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1071]
Molecular Weight: 86kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE
Target: A synthetic peptide corresponding to a sequence within amino acids 649-748 of human STAT4 (NP_003142.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000