DHX9/RNA Helicase A Rabbit mAb, Clone: [ARC1033], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4563S
Article Name: DHX9/RNA Helicase A Rabbit mAb, Clone: [ARC1033], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4563S
Supplier Catalog Number: CNA4563S
Alternative Catalog Number: MBL-CNA4563S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DHX9/RNA Helicase A (Q08211).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1033]
Molecular Weight: 141kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
Target: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DHX9/RNA Helicase A (Q08211).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:1000 - 1:5000