[KO Validated] Histone H2A.Z Rabbit mAb, Clone: [ARC1048], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA4599S
Article Name: |
[KO Validated] Histone H2A.Z Rabbit mAb, Clone: [ARC1048], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA4599S |
Supplier Catalog Number: |
CNA4599S |
Alternative Catalog Number: |
MBL-CNA4599S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ChIP, WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5). |
Conjugation: |
Unconjugated |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC1048] |
Molecular Weight: |
13kDa |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL |
Target: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5). |
Application Dilute: |
WB: WB,1:1000 - 1:5000|ChIP,1:50 - 1:200 |