[KO Validated] MTA2 Rabbit mAb, Clone: [ARC1056], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4624S
Article Name: [KO Validated] MTA2 Rabbit mAb, Clone: [ARC1056], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4624S
Supplier Catalog Number: CNA4624S
Alternative Catalog Number: MBL-CNA4624S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1056]
Molecular Weight: 75kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED
Target: A synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500|ChIP,1:100 - 1:500