TIMM10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA4626S
Article Name: TIMM10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA4626S
Supplier Catalog Number: CNA4626S
Alternative Catalog Number: MBL-CNA4626S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TIMM10 (NP_036588.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 10kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TIMM10 (NP_036588.1).
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200