MRPS28 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA4660T
Article Name: MRPS28 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA4660T
Supplier Catalog Number: CNA4660T
Alternative Catalog Number: MBL-CNA4660T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human MRPS28 (NP_054737.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 21kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human MRPS28 (NP_054737.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:20 - 1:100