SMC1 Rabbit mAb, Clone: [ARC1095], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4693S
Article Name: SMC1 Rabbit mAb, Clone: [ARC1095], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4693S
Supplier Catalog Number: CNA4693S
Alternative Catalog Number: MBL-CNA4693S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1134-1233 of human SMC1 (Q14683).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1095]
Molecular Weight: 143kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
Target: A synthetic peptide corresponding to a sequence within amino acids 1134-1233 of human SMC1 (Q14683).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200