Troponin I2 (TNNI2) Rabbit mAb, Clone: [ARC1114], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4740S
Article Name: Troponin I2 (TNNI2) Rabbit mAb, Clone: [ARC1114], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4740S
Supplier Catalog Number: CNA4740S
Alternative Catalog Number: MBL-CNA4740S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1114]
Molecular Weight: 21kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
Target: A synthetic peptide corresponding to a sequence within amino acids 83-182 of human Troponin I2 (Troponin I2 (TNNI2)) (P48788).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200