ALAS1 Rabbit mAb, Clone: [ARC0239], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4817S
Article Name: ALAS1 Rabbit mAb, Clone: [ARC0239], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4817S
Supplier Catalog Number: CNA4817S
Alternative Catalog Number: MBL-CNA4817S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 541-640 of human ALAS1 (P13196).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0239]
Molecular Weight: 71kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLELKPHSSAECNFCRRPLHFEVMSEREKSYFSGLSKLVSAQA
Target: A synthetic peptide corresponding to a sequence within amino acids 541-640 of human ALAS1 (P13196).
Application Dilute: WB: WB,1:500 - 1:1000