CD20 Rabbit mAb, Clone: [ARC51683], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4893P
Article Name: CD20 Rabbit mAb, Clone: [ARC51683], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4893P
Supplier Catalog Number: CNA4893P
Alternative Catalog Number: MBL-CNA4893P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, ICC, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC51683]
Molecular Weight: 33kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000|IF/ICC,1:500 - 1:1000|FC,1:50 - 1:200