Arginase 1 (ARG1) Rabbit mAb, Clone: [ARC1164], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4923S
Article Name: Arginase 1 (ARG1) Rabbit mAb, Clone: [ARC1164], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4923S
Supplier Catalog Number: CNA4923S
Alternative Catalog Number: MBL-CNA4923S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1164]
Molecular Weight: 35kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089).
Application Dilute: WB: WB,1:2000 - 1:6000|IF/ICC,1:50 - 1:200