Myosin heavy chain Rabbit mAb, Clone: [ARC1170], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4963S
Article Name: Myosin heavy chain Rabbit mAb, Clone: [ARC1170], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4963S
Supplier Catalog Number: CNA4963S
Alternative Catalog Number: MBL-CNA4963S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1400 of human Myosin heavy chain (P12883).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1170]
Molecular Weight: 224kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: VAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1400 of human Myosin heavy chain (P12883).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200