Alpha-1 Antitrypsin (SERPINA1) Rabbit mAb, Clone: [ARC1212], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA4966S
| Article Name: |
Alpha-1 Antitrypsin (SERPINA1) Rabbit mAb, Clone: [ARC1212], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA4966S |
| Supplier Catalog Number: |
CNA4966S |
| Alternative Catalog Number: |
MBL-CNA4966S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-418 of human Alpha-1 Antitrypsin (SERPINA1) (NP_000286.3). |
| Conjugation: |
Unconjugated |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC1212] |
| Molecular Weight: |
47kDa |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQ |
| Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-418 of human Alpha-1 Antitrypsin (SERPINA1) (NP_000286.3). |
| Application Dilute: |
WB: WB,1:1000 - 1:5000 |
