CYPOR Rabbit mAb, Clone: [ARC1981], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5032S
Article Name: CYPOR Rabbit mAb, Clone: [ARC1981], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5032S
Supplier Catalog Number: CNA5032S
Alternative Catalog Number: MBL-CNA5032S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human CYPOR (P16435).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1981]
Molecular Weight: 77kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRI
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human CYPOR (P16435).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200