CYP17A1 Rabbit mAb, Clone: [ARC1257], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5067S
Article Name: CYP17A1 Rabbit mAb, Clone: [ARC1257], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5067S
Supplier Catalog Number: CNA5067S
Alternative Catalog Number: MBL-CNA5067S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1257]
Molecular Weight: 57kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPW
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200