PSME1 Rabbit mAb, Clone: [ARC1254], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5070S
Article Name: PSME1 Rabbit mAb, Clone: [ARC1254], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5070S
Supplier Catalog Number: CNA5070S
Alternative Catalog Number: MBL-CNA5070S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PSME1(NP_006254.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1254]
Molecular Weight: 29kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PSME1(NP_006254.1).
Application Dilute: WB: WB,1:500 - 1:1000