PAR2 Rabbit mAb, Clone: [ARC1246], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5103S
Article Name: PAR2 Rabbit mAb, Clone: [ARC1246], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5103S
Supplier Catalog Number: CNA5103S
Alternative Catalog Number: MBL-CNA5103S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 298-397 of human PAR2 (P55085).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1246]
Molecular Weight: 44kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
Target: A synthetic peptide corresponding to a sequence within amino acids 298-397 of human PAR2 (P55085).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200