CRYAA Rabbit mAb, Clone: [ARC1245], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5111S
Article Name: CRYAA Rabbit mAb, Clone: [ARC1245], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5111S
Supplier Catalog Number: CNA5111S
Alternative Catalog Number: MBL-CNA5111S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human CRYAA (P02489).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1245]
Molecular Weight: 20kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human CRYAA (P02489).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200