EBP1/PA2G4 Rabbit mAb, Clone: [ARC1281], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5114S
Article Name: EBP1/PA2G4 Rabbit mAb, Clone: [ARC1281], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5114S
Supplier Catalog Number: CNA5114S
Alternative Catalog Number: MBL-CNA5114S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1281]
Molecular Weight: 44kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200