DNAJC19 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5146S
Article Name: DNAJC19 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5146S
Supplier Catalog Number: CNA5146S
Alternative Catalog Number: MBL-CNA5146S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 12kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200