Rad23A Rabbit mAb, Clone: [ARC1271], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5147S
Article Name: Rad23A Rabbit mAb, Clone: [ARC1271], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5147S
Supplier Catalog Number: CNA5147S
Alternative Catalog Number: MBL-CNA5147S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Rad23A (P54725).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1271]
Molecular Weight: 40kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
Target: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Rad23A (P54725).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200