RUVBL1/TIP49A/PONTIN Rabbit mAb, Clone: [ARC1247], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5180S
Article Name: RUVBL1/TIP49A/PONTIN Rabbit mAb, Clone: [ARC1247], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5180S
Supplier Catalog Number: CNA5180S
Alternative Catalog Number: MBL-CNA5180S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-456 of human RUVBL1/TIP49A/PONTIN (Q9Y265).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1247]
Molecular Weight: 50kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: IPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
Target: A synthetic peptide corresponding to a sequence within amino acids 350-456 of human RUVBL1/TIP49A/PONTIN (Q9Y265).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ChIP,1:50 - 1:200