IGF2BP2/IMP2 Rabbit mAb, Clone: [ARC1203], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5189S
Article Name: IGF2BP2/IMP2 Rabbit mAb, Clone: [ARC1203], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5189S
Supplier Catalog Number: CNA5189S
Alternative Catalog Number: MBL-CNA5189S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-595 of human IGF2BP2/IMP2 (NP_001007226.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1203]
Molecular Weight: 66kDa/62kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVAS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 500-595 of human IGF2BP2/IMP2 (NP_001007226.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000