P23/PTGES3 Rabbit mAb, Clone: [ARC1986], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5194S
Article Name: P23/PTGES3 Rabbit mAb, Clone: [ARC1986], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5194S
Supplier Catalog Number: CNA5194S
Alternative Catalog Number: MBL-CNA5194S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/PTGES3 (NP_006592.3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1986]
Molecular Weight: 19kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/PTGES3 (NP_006592.3).
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200