Snail Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5243T
Article Name: Snail Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5243T
Supplier Catalog Number: CNA5243T
Alternative Catalog Number: MBL-CNA5243T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-267 of human SNAI1 (NP_005976.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 29kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Target: A synthetic peptide corresponding to a sequence within amino acids 200-267 of human SNAI1 (NP_005976.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200