RGAP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5298P
Article Name: RGAP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5298P
Supplier Catalog Number: CNA5298P
Alternative Catalog Number: MBL-CNA5298P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 353-632 of human RGAP1 (NP_001119576.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 71kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: DFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNT
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 353-632 of human RGAP1 (NP_001119576.1).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200