[KO Validated] HADHA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5346S
Article Name: [KO Validated] HADHA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5346S
Supplier Catalog Number: CNA5346S
Alternative Catalog Number: MBL-CNA5346S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 83kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
Application Dilute: WB: WB,1:2000 - 1:6000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100