Myelin oligodendrocyte glycoprotein Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5353P
Article Name: Myelin oligodendrocyte glycoprotein Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5353P
Supplier Catalog Number: CNA5353P
Alternative Catalog Number: MBL-CNA5353P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-154 of human Myelin oligodendrocyte glycoprotein (NP_996532.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 28kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 30-154 of human Myelin oligodendrocyte glycoprotein (NP_996532.2).
Application Dilute: WB: WB,1:500 - 1:1000