Rad18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5380S
Article Name: Rad18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5380S
Supplier Catalog Number: CNA5380S
Alternative Catalog Number: MBL-CNA5380S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 216-495 of human Rad18 (NP_064550.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 56kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: INKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 216-495 of human Rad18 (NP_064550.3).
Application Dilute: WB: WB,1:500 - 1:2000