CART Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5395T
Article Name: CART Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5395T
Supplier Catalog Number: CNA5395T
Alternative Catalog Number: MBL-CNA5395T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-116 of human CART (NP_004282.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 13kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Target: A synthetic peptide corresponding to a sequence within amino acids 50-116 of human CART (NP_004282.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200