PSMB10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5452T
Article Name: PSMB10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5452T
Supplier Catalog Number: CNA5452T
Alternative Catalog Number: MBL-CNA5452T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (NP_002792.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 29kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQT
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (NP_002792.1).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100