Myoglobin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5471S
Article Name: Myoglobin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5471S
Supplier Catalog Number: CNA5471S
Alternative Catalog Number: MBL-CNA5471S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-154 of human Myoglobin (NP_005359.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 17kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-154 of human Myoglobin (NP_005359.1).
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:100 - 1:500