PRPF3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5482S
Article Name: PRPF3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5482S
Supplier Catalog Number: CNA5482S
Alternative Catalog Number: MBL-CNA5482S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PRPF3 (NP_004689.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 78kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPT
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PRPF3 (NP_004689.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100