[KO Validated] S100A11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5486S
Article Name: [KO Validated] S100A11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5486S
Supplier Catalog Number: CNA5486S
Alternative Catalog Number: MBL-CNA5486S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 12kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000