TLE1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5501S
Article Name: TLE1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5501S
Supplier Catalog Number: CNA5501S
Alternative Catalog Number: MBL-CNA5501S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 501-770 of human TLE1 (NP_005068.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 83kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYI
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 501-770 of human TLE1 (NP_005068.2).
Application Dilute: WB: WB,1:500 - 1:2000