CGRP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5542P
Article Name: CGRP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5542P
Supplier Catalog Number: CNA5542P
Alternative Catalog Number: MBL-CNA5542P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 49-128 of human CGRP (NP_001029125.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 13kDa/15kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LLLAALVQDYVQMKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA
Target: A synthetic peptide corresponding to a sequence within amino acids 49-128 of human CGRP (NP_001029125.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200