ICAM-1/CD54 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5597P
Article Name: ICAM-1/CD54 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5597P
Supplier Catalog Number: CNA5597P
Alternative Catalog Number: MBL-CNA5597P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human ICAM-1/CD54 (NP_000192.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 58kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: PLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human ICAM-1/CD54 (NP_000192.2).
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200