ABCG2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5661P
Article Name: ABCG2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5661P
Supplier Catalog Number: CNA5661P
Alternative Catalog Number: MBL-CNA5661P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG2 (NP_004818.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 72kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG2 (NP_004818.2).
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200