CDKN2B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA5685P
| Article Name: |
CDKN2B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA5685P |
| Supplier Catalog Number: |
CNA5685P |
| Alternative Catalog Number: |
MBL-CNA5685P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 59-138 of human CDKN2B (NP_004927.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
15kDa |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
ARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 59-138 of human CDKN2B (NP_004927.2). |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
