CRYAA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5725S
Article Name: CRYAA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5725S
Supplier Catalog Number: CNA5725S
Alternative Catalog Number: MBL-CNA5725S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat, Zebrafish
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human CRYAA (NP_000385.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 20kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human CRYAA (NP_000385.1).
Application Dilute: WB: WB,1:2000 - 1:6000|IF/ICC,1:50 - 1:200