PP2A-Aalpha/PR65alpha/PPP2R1A Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PP2A-Aalpha/PR65alpha/PPP2R1A Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA5799S
• Supplier Catalog Number: CNA5799S
• Alternative Catalog Number: MBL-CNA5799S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PP2A-Aalpha/PR65alpha/PP2A-Aalpha/PR65alpha/PPP2R1A (NP_055040.2).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 65kDa
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAED
• Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PP2A-Aalpha/PR65alpha/PP2A-Aalpha/PR65alpha/PPP2R1A (NP_055040.2).

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100