BTAF1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA5811S
| Article Name: |
BTAF1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA5811S |
| Supplier Catalog Number: |
CNA5811S |
| Alternative Catalog Number: |
MBL-CNA5811S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, IP, WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
207kDa |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
LAVQNSSLHDIQHAPKLSALKQLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK |
| Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1). |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:20 - 1:50|ChIP,1:20 - 1:100 |
