TTC11/FIS1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA5821P
Article Name: TTC11/FIS1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA5821P
Supplier Catalog Number: CNA5821P
Alternative Catalog Number: MBL-CNA5821P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 17kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000