67kDa Laminin Receptor Rabbit mAb, Clone: [ARC2109], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5968S
Article Name: 67kDa Laminin Receptor Rabbit mAb, Clone: [ARC2109], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5968S
Supplier Catalog Number: CNA5968S
Alternative Catalog Number: MBL-CNA5968S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2109]
Molecular Weight: 33kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS
Target: A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200