Syntaxin 4 Rabbit mAb, Clone: [ARC2113], Unconjugated, Monoclonal

Catalog Number: MBL-CNA5996S
Article Name: Syntaxin 4 Rabbit mAb, Clone: [ARC2113], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA5996S
Supplier Catalog Number: CNA5996S
Alternative Catalog Number: MBL-CNA5996S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2113]
Molecular Weight: 34kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
Target: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200