TNRC6A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA6115S
Article Name: TNRC6A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA6115S
Supplier Catalog Number: CNA6115S
Alternative Catalog Number: MBL-CNA6115S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 210kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS
Target: A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:100